PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G454000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family GRF
Protein Properties Length: 392aa    MW: 43662.7 Da    PI: 7.1371
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G454000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.85.1e-25160204145
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                        d+epgrCrRtDGKkWRC ++v++g+k+CErH+hrgr+rsrk++e+
  Aqcoe1G454000.1.p 160 DPEPGRCRRTDGKKWRCAKDVVAGQKYCERHMHRGRNRSRKPVES 204
                        79****************************************997 PP

2QLQ37.29.1e-1488120335
                QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                        F+ +Q+ +L+ Q+l++Ky++ ++P+P eL+  i
  Aqcoe1G454000.1.p  88 FSFTQWRELELQALIFKYMLVKAPIPVELIDSI 120
                        99***************************9777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166614.43787122IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-988120IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.471160204IPR014977WRC domain
PfamPF088799.1E-22161203IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAYHVKQEWY EQYESEHLCC SKLPPRLIYD DTELPHQLSE SAALPLFVPE LNNTRITSLS  60
AFSDSTLTPS PTTTTTTTAR LARLRCCFSF TQWRELELQA LIFKYMLVKA PIPVELIDSI  120
KFSLPHNYPG CYLYQPLHLQ QYSYYKPSML RTGYWGNSVD PEPGRCRRTD GKKWRCAKDV  180
VAGQKYCERH MHRGRNRSRK PVESSTQPTA SGGLRTATLI GSSPSTTEAT GIHFALSVPA  240
PTPLNTRYPE IKQEIVLLED QCDNKYSENR TDGGQTRHFF DDWPRSQQEP NGININAKPE  300
NLPAGDCQPS SDFSLKLATG NGDEQSSRDG DIGTGEHNRL SWGTEWGNHQ MSSMGGPLAE  360
ALQHSASSSS PTSVLRGATH RSVSDLSGVS T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243928.11e-107PREDICTED: growth-regulating factor 3
TrEMBLF6HKI61e-104F6HKI6_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g03760.t011e-103(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.11e-56growth-regulating factor 4